Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN1 Peptide - middle region

SPIN1 Peptide - middle region

Product Specifications

Product Name Alternative

SPIN

UniProt

Q9Y657

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIN1 Rabbit Polyclonal Antibody (orb581635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006708

Preservative

Lyophilized powder

AA Sequence

YQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DLD ELISA Kit (Ready to Use)
orb553270-01 48 Tests

Mouse DLD ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse DLD ELISA Kit (Ready to Use)
orb553270-02 96 Tests

Mouse DLD ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
C1orf130 Protein Vector (Human) (pPB-N-His)
PV049742 500 ng

C1orf130 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
VPS33B siRNA (Human)
CRH8798-01 15 nmol

VPS33B siRNA (Human)

Sign In for Pricing
View Details
VPS33B siRNA (Human)
CRH8798-02 30 nmol

VPS33B siRNA (Human)

Sign In for Pricing
View Details
Ac2-26 acetate
orb1679696-01 1 mg

Ac2-26 acetate

Sign In for Pricing
View Details