STH Peptide - middle region
STH Peptide - middle region
Product Specifications
Product Name Alternative
MAPTIT, MGC163191, MGC163193
UniProt
Q8IWL8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STH Rabbit Polyclonal Antibody (orb326460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007533
Preservative
Lyophilized powder
AA Sequence
SSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7233721-01 48 Well
Canine ATP-binding cassette sub-family A member 12 (ABCA12) ELISA Kit
Sign In for Pricing
View Details MBS7233721-02 96 Well
Canine ATP-binding cassette sub-family A member 12 (ABCA12) ELISA Kit
Sign In for Pricing
View Details MBS7233721-03 5x 96 Well
Canine ATP-binding cassette sub-family A member 12 (ABCA12) ELISA Kit
Sign In for Pricing
View Details MBS7233721-04 10x 96 Well
Canine ATP-binding cassette sub-family A member 12 (ABCA12) ELISA Kit
Sign In for Pricing
View Details