Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Peptide - middle region

SUPT4H1 Peptide - middle region

Product Specifications

Product Name Alternative

SPT4H, SUPT4H, SPT4

UniProt

P63272

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUPT4H1 Rabbit Polyclonal Antibody (orb324757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003159

Preservative

Lyophilized powder

AA Sequence

NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmip (NM_001163273) Rat Tagged ORF Clone
RR217196 10 µg

Cmip (NM_001163273) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Transcriptional Repressor CTCF (CTCF) Antibody
abx001047-01 60 µL

Transcriptional Repressor CTCF (CTCF) Antibody

Sign In for Pricing
View Details
Transcriptional Repressor CTCF (CTCF) Antibody
abx001047-02 120 µL

Transcriptional Repressor CTCF (CTCF) Antibody

Sign In for Pricing
View Details
Transcriptional Repressor CTCF (CTCF) Antibody
abx001047-03 200 µL

Transcriptional Repressor CTCF (CTCF) Antibody

Sign In for Pricing
View Details
G3BP1 Protein
OPPA02533-2UG 2 µg

G3BP1 Protein

Sign In for Pricing
View Details
LOC680799-set siRNA/shRNA/RNAi Lentivector (Rat)
27371096 4x 500 ng

LOC680799-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details