Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Peptide - middle region

SUPT4H1 Peptide - middle region

Product Specifications

Product Name Alternative

SPT4H, SUPT4H, SPT4

UniProt

P63272

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUPT4H1 Rabbit Polyclonal Antibody (orb324757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003159

Preservative

Lyophilized powder

AA Sequence

NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN6 Recombinant Antibody, Biotin Conjugated
bsm-61171R-Biotin-TR 20 µL

PTPN6 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
UNC0321 1mg
A13200-1 1 mg

UNC0321 1mg

Sign In for Pricing
View Details
Glycophorin A Rabbit Polyclonal Antibody (PE)
orb490452 100 µL

Glycophorin A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CD44 (NM_001001389) Human Tagged ORF Clone
RG202455 10 µg

CD44 (NM_001001389) Human Tagged ORF Clone

Sign In for Pricing
View Details
Vom2r3 Protein Vector (Rat) (pPM-C-HA)
50108026 500 ng

Vom2r3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human RIPOR2 shRNA (UAS) - Lentiviral human RIPOR2 shRNA (UAS, iRFP) (25)
GTR15105302 1 Vial

Lentiviral human RIPOR2 shRNA (UAS) - Lentiviral human RIPOR2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details