Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT2 Peptide - C-terminal region

SYT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ42519, SytII

UniProt

Q8N9I0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT2 Rabbit Polyclonal Antibody (orb584350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_796376

Preservative

Lyophilized powder

AA Sequence

AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNS10 (RNASE10) activation kit by CRISPRa
GA117396 1 Kit

Human RNS10 (RNASE10) activation kit by CRISPRa

Sign In for Pricing
View Details
NDST1 Human Gene Knockout Kit (CRISPR)
KN221638RB 1 Kit

NDST1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) pThr198 Rabbit Polyclonal Antibody
AP12943PU-N 400 µL

p27 KIP 1 (CDKN1B) pThr198 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HACE1 Polyclonal Antibody
E-AB-16474-01 20 µL

HACE1 Polyclonal Antibody

Sign In for Pricing
View Details
HACE1 Polyclonal Antibody
E-AB-16474-02 60 µL

HACE1 Polyclonal Antibody

Sign In for Pricing
View Details
HACE1 Polyclonal Antibody
E-AB-16474-03 120 µL

HACE1 Polyclonal Antibody

Sign In for Pricing
View Details