Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT2 Peptide - C-terminal region

SYT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ42519, SytII

UniProt

Q8N9I0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT2 Rabbit Polyclonal Antibody (orb584350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_796376

Preservative

Lyophilized powder

AA Sequence

AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C13orf1 (SPRYD7) Human Gene Knockout Kit (CRISPR)
KN423236 1 Kit

C13orf1 (SPRYD7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAB39L Human Gene Knockout Kit (CRISPR)
KN203394LP 1 Kit

CAB39L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF594 conjugate, 0.1mg/mL
BNC942347-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PLOD1 activation kit by CRISPRa
GA103610 1 Kit

Human PLOD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp334 Mouse Gene Knockout Kit (CRISPR)
KN519791 1 Kit

Zfp334 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Col23a1 Mouse Gene Knockout Kit (CRISPR)
KN503628 1 Kit

Col23a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details