Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf1b Peptide - middle region

Taf1b Peptide - middle region

Product Specifications

Product Name Alternative

4930408G01Rik, A230108M10Rik, Tafi86, mTAFI68, TAFI68

UniProt

P97358

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf1b Rabbit Polyclonal Antibody (orb576269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065639

Preservative

Lyophilized powder

AA Sequence

KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin Type A Receptor 1 (EPHA1) Porcine ELISA Kit
D1972 96 Tests

Ephrin Type A Receptor 1 (EPHA1) Porcine ELISA Kit

Sign In for Pricing
View Details
KIF3A 3'UTR GFP Stable Cell Line
TU061754 1.0 mL

KIF3A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DUS3L Peptide - N-terminal region (AAP70159)
AAP70159-100UG 100 µg

DUS3L Peptide - N-terminal region (AAP70159)

Sign In for Pricing
View Details
LRPPRC Rabbit Polyclonal Antibody
E10G33943 100 µL

LRPPRC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SH3BP5 Antibody (N-Term)
E45R09914G-4 50 µL

SH3BP5 Antibody (N-Term)

Sign In for Pricing
View Details
Rabbit Polyclonal MAEL Antibody
NBP2-69070-25ul 25 µL

Rabbit Polyclonal MAEL Antibody

Sign In for Pricing
View Details