Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf1b Peptide - middle region

Taf1b Peptide - middle region

Product Specifications

Product Name Alternative

4930408G01Rik, A230108M10Rik, Tafi86, mTAFI68, TAFI68

UniProt

P97358

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf1b Rabbit Polyclonal Antibody (orb576269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065639

Preservative

Lyophilized powder

AA Sequence

KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Rac)-Azide-phenylalanine
MBS5799775 Inquire

(Rac)-Azide-phenylalanine

Sign In for Pricing
View Details
IL-17RB Polyclonal Antibody
BT-AP04452-01 20 µL

IL-17RB Polyclonal Antibody

Sign In for Pricing
View Details
IL-17RB Polyclonal Antibody
BT-AP04452-02 50 µL

IL-17RB Polyclonal Antibody

Sign In for Pricing
View Details
IL-17RB Polyclonal Antibody
BT-AP04452-03 100 µL

IL-17RB Polyclonal Antibody

Sign In for Pricing
View Details
DLL3 Rabbit pAb
A18192 50 µL

DLL3 Rabbit pAb

Sign In for Pricing
View Details
Pdcl2 3'UTR GFP Stable Cell Line
TU166092 1.0 mL

Pdcl2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details