Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARP Peptide - N-terminal region

TARP Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD3G, TCRG, TCRGC1, TCRGC2

UniProt

Q0VGM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARP Rabbit Polyclonal Antibody (orb584793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003806

Preservative

Lyophilized powder

AA Sequence

YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein F (APOF) (NM_001638) Human Over-expression Lysate
LY400616 100 µg

Apolipoprotein F (APOF) (NM_001638) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), Biotin conjugate, 0.1mg/mL
BNCB2074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), Biotin conjugate, 0.1mg/mL
BNCB2483-100 1x 100 µL

Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYL4 Rabbit Polyclonal Antibody
HA500471 100 µL

MYL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF568 conjugate, 0.1mg/mL
BNC682113-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Borcs7 (NM_025563) Mouse Tagged ORF Clone
MG200354 10 µg

Borcs7 (NM_025563) Mouse Tagged ORF Clone

Sign In for Pricing
View Details