Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARP Peptide - N-terminal region

TARP Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD3G, TCRG, TCRGC1, TCRGC2

UniProt

Q0VGM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARP Rabbit Polyclonal Antibody (orb584793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003806

Preservative

Lyophilized powder

AA Sequence

YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HRCT1 activation kit by CRISPRa
GA118795 1 Kit

Human HRCT1 activation kit by CRISPRa

Sign In for Pricing
View Details
NAA60 (NM_001083601) Human Over-expression Lysate
LC421227 20 µg

NAA60 (NM_001083601) Human Over-expression Lysate

Sign In for Pricing
View Details
AdSS 2 (ADSS) (NM_001126) Human Recombinant Protein
TP304256 20 µg

AdSS 2 (ADSS) (NM_001126) Human Recombinant Protein

Sign In for Pricing
View Details
OR4P4 Antibody
8G612-AAT 50 µg

OR4P4 Antibody

Sign In for Pricing
View Details
5-Chlorovaleryl Chloride
TRC-C382545-500MG 500 mg

5-Chlorovaleryl Chloride

Sign In for Pricing
View Details
RHNO1 Human Gene Knockout Kit (CRISPR)
KN432195 1 Kit

RHNO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details