Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea2 Peptide - middle region

Tcea2 Peptide - middle region

Product Specifications

Product Name Alternative

AI326274, S-II-T1, SII-T1, Tceat

UniProt

Q9QVN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea2 Rabbit Polyclonal Antibody (orb324674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033352

Preservative

Lyophilized powder

AA Sequence

KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,6-Trichlorobenzoic acid
TRC-T774718-250MG 250 mg

2,3,6-Trichlorobenzoic acid

Sign In for Pricing
View Details
Guinea Pig Clarin 1 (CLRN1) ELISA kit
GTR10423402 96 Well

Guinea Pig Clarin 1 (CLRN1) ELISA kit

Sign In for Pricing
View Details
KRAS G12C Inhibitor 56
MBS5814782 Inquire

KRAS G12C Inhibitor 56

Sign In for Pricing
View Details
UCP-2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb968974 100 µL

UCP-2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Recombinant Telomerase Reverse Transcriptase (TERT)
MBS2010863-01 0.01 mg

Recombinant Telomerase Reverse Transcriptase (TERT)

Sign In for Pricing
View Details
Recombinant Telomerase Reverse Transcriptase (TERT)
MBS2010863-02 0.05 mg

Recombinant Telomerase Reverse Transcriptase (TERT)

Sign In for Pricing
View Details