Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea2 Peptide - middle region

Tcea2 Peptide - middle region

Product Specifications

Product Name Alternative

AI326274, S-II-T1, SII-T1, Tceat

UniProt

Q9QVN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea2 Rabbit Polyclonal Antibody (orb324674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033352

Preservative

Lyophilized powder

AA Sequence

KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHDC1 Antibody
orb309598 100 µL

KHDC1 Antibody

Sign In for Pricing
View Details
Kaempferol 3-O-malonylglucoside
orb3159230 5 mg

Kaempferol 3-O-malonylglucoside

Sign In for Pricing
View Details
Kanamycin acid sulfate Solution 50mg/ml ≥670U/mg, 50ml
1291-50ml 50 mL

Kanamycin acid sulfate Solution 50mg/ml ≥670U/mg, 50ml

Sign In for Pricing
View Details
Human Adiponectin Matched Antibody Pair Set [IV04101/RD0430]
Z01LS-0423-LS8 5 Plates

Human Adiponectin Matched Antibody Pair Set [IV04101/RD0430]

Sign In for Pricing
View Details
IP3KC Antibody
8C11487-AAT 50 µg

IP3KC Antibody

Sign In for Pricing
View Details
Bovine cTnI ELISA Kit
EBT0498 96 Tests

Bovine cTnI ELISA Kit

Sign In for Pricing
View Details