Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb331239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110379

Preservative

Lyophilized powder

AA Sequence

HNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzidine, 95%
MBS6047265-01 25 g

Benzidine, 95%

Sign In for Pricing
View Details
Benzidine, 95%
MBS6047265-02 5x 25 g

Benzidine, 95%

Sign In for Pricing
View Details
FUT6 Antibody (Center) [APR05362G]
APR05362G-01 50 µL

FUT6 Antibody (Center) [APR05362G]

Sign In for Pricing
View Details
FUT6 Antibody (Center) [APR05362G]
APR05362G-02 100 µL

FUT6 Antibody (Center) [APR05362G]

Sign In for Pricing
View Details
FUT6 Antibody (Center) [APR05362G]
APR05362G-03 200 µL

FUT6 Antibody (Center) [APR05362G]

Sign In for Pricing
View Details
FUT6 Antibody (Center) [APR05362G]
APR05362G-04 400 µL

FUT6 Antibody (Center) [APR05362G]

Sign In for Pricing
View Details