Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb331239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110379

Preservative

Lyophilized powder

AA Sequence

HNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S1P4/EDG-6 Antibody (1012512) [DyLight 405]
FAB10321E 0.1 mL

Mouse Monoclonal S1P4/EDG-6 Antibody (1012512) [DyLight 405]

Sign In for Pricing
View Details
Human Uroplakin III (UPK3A) activation kit by CRISPRa
GA105086 1 Kit

Human Uroplakin III (UPK3A) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Regenerating Islet-Derived 3 Alpha
MBS142975-01 0.002 mg

Recombinant Human Regenerating Islet-Derived 3 Alpha

Sign In for Pricing
View Details
Recombinant Human Regenerating Islet-Derived 3 Alpha
MBS142975-02 0.01 mg

Recombinant Human Regenerating Islet-Derived 3 Alpha

Sign In for Pricing
View Details
Recombinant Human Regenerating Islet-Derived 3 Alpha
MBS142975-03 1 mg

Recombinant Human Regenerating Islet-Derived 3 Alpha

Sign In for Pricing
View Details
Recombinant Human Regenerating Islet-Derived 3 Alpha
MBS142975-04 5x 1 mg

Recombinant Human Regenerating Islet-Derived 3 Alpha

Sign In for Pricing
View Details