Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfdp1 Peptide - N-terminal region

Tfdp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dp1, Drtf1

UniProt

Q08639

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfdp1 Rabbit Polyclonal Antibody (orb576880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033387

Preservative

Lyophilized powder

AA Sequence

NLSPGKGVVSLVAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVIGTPQRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urea-d4
TRC-U822506-1G 1 g

Urea-d4

Sign In for Pricing
View Details
Recombinant Human TL1A protein (His Tag)
PKSH034127-01 20 µg

Recombinant Human TL1A protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TL1A protein (His Tag)
PKSH034127-02 100 µg

Recombinant Human TL1A protein (His Tag)

Sign In for Pricing
View Details
CD105 Antibody
KC-8392-01 50 μL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-8392-02 100 µL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-8392-03 1 mL

CD105 Antibody

Sign In for Pricing
View Details