Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfdp1 Peptide - N-terminal region

Tfdp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dp1, Drtf1

UniProt

Q08639

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfdp1 Rabbit Polyclonal Antibody (orb576880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033387

Preservative

Lyophilized powder

AA Sequence

NLSPGKGVVSLVAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVIGTPQRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E12]
TA800765BM 100 µL

SOAT 2 (SOAT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E12]

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR561369 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
13-Epi-Manool
TRC-E381430-100MG 100 mg

13-Epi-Manool

Sign In for Pricing
View Details
ACY1 Antibody
KC-2946-01 50 μL

ACY1 Antibody

Sign In for Pricing
View Details
ACY1 Antibody
KC-2946-02 100 µL

ACY1 Antibody

Sign In for Pricing
View Details
ACY1 Antibody
KC-2946-03 1 mL

ACY1 Antibody

Sign In for Pricing
View Details