Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timp2 Peptide - C-terminal region

Timp2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D11Bwg1104e, Timp-2, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2

UniProt

Q8BSJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Timp2 Rabbit Polyclonal Antibody (orb578341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035724

Preservative

Lyophilized powder

AA Sequence

ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ZIKV (strain Zika SPH2015) NS5 protein (His Tag)
MBS2569605-01 0.1 mg

Recombinant ZIKV (strain Zika SPH2015) NS5 protein (His Tag)

Sign In for Pricing
View Details
Recombinant ZIKV (strain Zika SPH2015) NS5 protein (His Tag)
MBS2569605-02 5x 0.1 mg

Recombinant ZIKV (strain Zika SPH2015) NS5 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MAST2 Protein, N-GST
bs-102152P-01 20 µg

Recombinant Human MAST2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human MAST2 Protein, N-GST
bs-102152P-02 50 µg

Recombinant Human MAST2 Protein, N-GST

Sign In for Pricing
View Details
OR5C1 Protein Lysate (Human) with C-Ha Tag
35423031 100 µg

OR5C1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lentiviral human CCN6 shRNA (UAS) - Lentiviral human CCN6 shRNA (UAS, RFP) (100)
GTR15328395 1 Vial

Lentiviral human CCN6 shRNA (UAS) - Lentiviral human CCN6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details