Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timp2 Peptide - C-terminal region

Timp2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D11Bwg1104e, Timp-2, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2

UniProt

Q8BSJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Timp2 Rabbit Polyclonal Antibody (orb578341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035724

Preservative

Lyophilized powder

AA Sequence

ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit
MBS264199-01 48 Well

Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit

Sign In for Pricing
View Details
Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit
MBS264199-02 96 Well

Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit

Sign In for Pricing
View Details
Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit
MBS264199-03 5x 96 Well

Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit

Sign In for Pricing
View Details
Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit
MBS264199-04 10x 96 Well

Goat Peroxisome Proliferator Activated Receptor Alpha (PPAR-alpha) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Malignant T-cell-amplified sequence 1
E15021c 96 Tests

ELISA Kit For Malignant T-cell-amplified sequence 1

Sign In for Pricing
View Details
PGBD3 (NM_170753) Human Over-expression Lysate
LH15000V 100 µg

PGBD3 (NM_170753) Human Over-expression Lysate

Sign In for Pricing
View Details