Tk1 Peptide - middle region
Tk1 Peptide - middle region
Product Specifications
Product Name Alternative
D530002A18Rik, Tk-1, Tk1a, Tk1b
UniProt
P04184
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tk1 Rabbit Polyclonal Antibody (orb584032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033413.2
Preservative
Lyophilized powder
AA Sequence
KAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-431382-LAC 200 µL
5033411D12Rik Lentiviral Activation Particles (m)
Sign In for Pricing
View Details 
GTR15115243 1 Vial
Lentiviral mouse Rpa2 shRNA (UAS) - Lentiviral mouse Rpa2 shRNA (UAS) plasmid
Sign In for Pricing
View Details 252282-ML405 100 µL
SUOX (Sulfite Oxidase) (MaxLight 405) discontinued
Sign In for Pricing
View Details