Tk1 Peptide - middle region
Tk1 Peptide - middle region
Product Specifications
Product Name Alternative
D530002A18Rik, Tk-1, Tk1a, Tk1b
UniProt
P04184
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tk1 Rabbit Polyclonal Antibody (orb584032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033413.2
Preservative
Lyophilized powder
AA Sequence
KAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGLEKEVEVIGGADK
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15093755 1 Vial
Lentiviral human FXYD1 shRNA (UAS) - Lentiviral human FXYD1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
C2108 96 Tests
CXC-Chemokine ligand 3 Like Protein 1 (CCL3L1) Mouse ELISA Kit
Sign In for Pricing
View Details VAng-Yyj2366-50gEcoli 50 µg (E. coli)
Recombinant Mycobacterium Leprae rpmI Protein (aa 1-64) (strain Br4923)
Sign In for Pricing
View Details 
MBS7150623 Inquire
Rabbit anti-Shigella flexneri rpsA Polyclonal Antibody
Sign In for Pricing
View Details GTR15305081 1 Vial
Lentiviral mouse Mef2b shRNA (UAS) - Lentiviral mouse Mef2b shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details