Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tm2d3 Peptide - C-terminal region

Tm2d3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110025I09Rik, 5930422O05Rik, Blp2

UniProt

Q8BJ83

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tm2d3 Rabbit Polyclonal Antibody (orb580921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081071

Preservative

Lyophilized powder

AA Sequence

TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YKT6 (NM_006555) Human Tagged Lenti ORF Clone
RC200260L1 10 µg

YKT6 (NM_006555) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine Growth Differentiation Factor 1 ELISA kit
GTR10399299 96 Well

Bovine Growth Differentiation Factor 1 ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a) [HRP]
NB300-153H 0.2 mL

Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a) [HRP]

Sign In for Pricing
View Details
S100P siRNA Oligos set (Human)
42948171 3x 5 nmol

S100P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Rat Free fatty acid receptor 1 (Ffar1)
MBS7014729-01 0.02 mg

Recombinant Rat Free fatty acid receptor 1 (Ffar1)

Sign In for Pricing
View Details
Recombinant Rat Free fatty acid receptor 1 (Ffar1)
MBS7014729-02 0.1 mg

Recombinant Rat Free fatty acid receptor 1 (Ffar1)

Sign In for Pricing
View Details