Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tm2d3 Peptide - C-terminal region

Tm2d3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110025I09Rik, 5930422O05Rik, Blp2

UniProt

Q8BJ83

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tm2d3 Rabbit Polyclonal Antibody (orb580921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081071

Preservative

Lyophilized powder

AA Sequence

TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGST2 Rabbit Polyclonal Antibody
TA356490 100 µL

MGST2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EFCAB10 Protein Vector (Human) (pPM-C-His)
PV074968 500 ng

EFCAB10 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SLC34A2 Rabbit Polyclonal Antibody
orb221984-01 50 μL

SLC34A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC34A2 Rabbit Polyclonal Antibody
orb221984-02 100 µL

SLC34A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC34A2 Rabbit Polyclonal Antibody
orb221984-03 200 µL

SLC34A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Phospholipase C Delta 1 (PLCd1)
MBS2120262-01 0.1 mL

APC-Linked Polyclonal Antibody to Phospholipase C Delta 1 (PLCd1)

Sign In for Pricing
View Details