MFSD13A Peptide - middle region
MFSD13A Peptide - middle region
Product Specifications
Product Name Alternative
TMEM180, C10orf77, bA18I14.8
UniProt
Q14CX5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MFSD13A Rabbit Polyclonal Antibody (orb580899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079065
Preservative
Lyophilized powder
AA Sequence
CLFIASNRVFTEGTCKLLTLVVTDLVDEDLVLNHRKQAASALLFGMVALVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
043708-AP 200 µL
VAPB, CT (VAPB, Vesicle-associated membrane protein-associated protein B/C) (AP) discontinued
Sign In for Pricing
View Details 
MBS6330234-01 0.2 mL
P2RX6, ID (P2RX6, P2RXL1, P2X6, P2X purinoceptor 6, ATP receptor, P2XM, Purinergic receptor, Purinergic receptor P2X-like 1) (Azide free) (HRP)
Sign In for Pricing
View Details