Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP1 Peptide - C-terminal region

TNIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABIN-1, KIAA0113, NAF1, VAN, nip40-1

UniProt

Q15025

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNIP1 Rabbit Polyclonal Antibody (orb585089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006049

Preservative

Lyophilized powder

AA Sequence

NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2 (NM_000657) Human Over-expression Lysate
LC424584 20 µg

BCL2 (NM_000657) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852C-01 20 Tests

FITC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
FITC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852C-02 100 Tests

FITC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
FITC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852C-03 2x 100 Tests

FITC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31103-01 50 μL

MHC Class I Antibody

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31103-02 100 µL

MHC Class I Antibody

Sign In for Pricing
View Details