Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP1 Peptide - C-terminal region

TNIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABIN-1, KIAA0113, NAF1, VAN, nip40-1

UniProt

Q15025

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNIP1 Rabbit Polyclonal Antibody (orb585089) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006049

Preservative

Lyophilized powder

AA Sequence

NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14 (KRT14/532), CF568 conjugate, 0.1mg/mL
BNC680532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCF2 (NM_001127651) Human Over-expression Lysate
LC426836 20 µg

NCF2 (NM_001127651) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IL-23, C-His Tag
HA211060-01 Inquire

Mouse IL-23, C-His Tag

Sign In for Pricing
View Details
Mouse IL-23, C-His Tag
HA211060-02 50 µg

Mouse IL-23, C-His Tag

Sign In for Pricing
View Details
Mouse IL-23, C-His Tag
HA211060-03 100 µg

Mouse IL-23, C-His Tag

Sign In for Pricing
View Details
RAB6A Polyclonal Antibody
E-AB-65871-01 60 µL

RAB6A Polyclonal Antibody

Sign In for Pricing
View Details