Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1L1 Peptide - C-terminal region

TOM1L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OK/KNS-CL.3, SRCASM

UniProt

O75674

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1L1 Rabbit Polyclonal Antibody (orb585143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005477

Preservative

Lyophilized powder

AA Sequence

LNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL2RA Rabbit pAb (APR25056N)
APR25056N-01 50 µL

IL2RA Rabbit pAb (APR25056N)

Sign In for Pricing
View Details
IL2RA Rabbit pAb (APR25056N)
APR25056N-02 100 µL

IL2RA Rabbit pAb (APR25056N)

Sign In for Pricing
View Details
IL2RA Rabbit pAb (APR25056N)
APR25056N-03 200 µL

IL2RA Rabbit pAb (APR25056N)

Sign In for Pricing
View Details
CD44 (2H12) Mouse Monoclonal Antibody
AMM03497-01 50 µL

CD44 (2H12) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD44 (2H12) Mouse Monoclonal Antibody
AMM03497-02 100 µL

CD44 (2H12) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD44 (2H12) Mouse Monoclonal Antibody
AMM03497-03 200 µL

CD44 (2H12) Mouse Monoclonal Antibody

Sign In for Pricing
View Details