TRIB3 Peptide - N-terminal region
TRIB3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C20orf97, NIPK, SINK, SKIP3, TRB3
UniProt
Q96RU7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIB3 Rabbit Polyclonal Antibody (orb583598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066981
Preservative
Lyophilized powder
AA Sequence
YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details