Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct)

Product Specifications

Product Name Alternative

Glutaminyl cyclase Short name:QC; Glutaminyl-tRNA cyclotransferase

Abbreviation

Recombinant Mouse Qpct protein

Gene Name

Qpct

UniProt

Q9CYK2

Expression Region

36-362aa

Organism

Mus musculus (Mouse)

Target Sequence

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity) .

Molecular Weight

41.6 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetraethylammonium (nitrate)
HY-W127677-01 1 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details
Tetraethylammonium (nitrate)
HY-W127677-02 5 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details
Tetraethylammonium (nitrate)
HY-W127677-03 10 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details
Tetraethylammonium (nitrate)
HY-W127677-04 25 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details
Tetraethylammonium (nitrate)
HY-W127677-05 50 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details
Tetraethylammonium (nitrate)
HY-W127677-06 100 g

Tetraethylammonium (nitrate)

Sign In for Pricing
View Details