Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Peptide - middle region

Tsc22d4 Peptide - middle region

Product Specifications

Product Name Alternative

0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2

UniProt

Q99PD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tsc22d4 Rabbit Polyclonal Antibody (orb324688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076399

Preservative

Lyophilized powder

AA Sequence

VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znrf1 (NM_001168623) Mouse Tagged ORF Clone
MR216538 10 µg

Znrf1 (NM_001168623) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL
BNC880787-500 1x 500 µL

TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Safe-Red
E36G108-R 1.0 mL

Safe-Red

Sign In for Pricing
View Details
Anti-CD22 Rabbit pAb
GB11869 100 μL

Anti-CD22 Rabbit pAb

Sign In for Pricing
View Details
p63 Rabbit pAb
E45R24655N 50 ul

p63 Rabbit pAb

Sign In for Pricing
View Details
ACTB (Actin, Cytoplasmic 1, Beta-actin) (FITC)
122915-FITC 100 µL

ACTB (Actin, Cytoplasmic 1, Beta-actin) (FITC)

Sign In for Pricing
View Details