Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Peptide - middle region

Tsc22d4 Peptide - middle region

Product Specifications

Product Name Alternative

0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2

UniProt

Q99PD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tsc22d4 Rabbit Polyclonal Antibody (orb324688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076399

Preservative

Lyophilized powder

AA Sequence

VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Avian Influenza A H7N9 Neuraminidase Antibody [Alexa Fluor 350]
NBP2-41280AF350 0.1 mL

Rabbit Polyclonal Avian Influenza A H7N9 Neuraminidase Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
TSPAN7 Polyclonal Antibody
A71422-100 100 µL

TSPAN7 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD2 Protein Vector (Human) (pPM-C-HA)
36261021 500 ng

PDCD2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
LGALS9 sgRNA CRISPR Lentivector set (Human)
K1210401 3x 1.0 µg

LGALS9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
MBS2581488-01 0.02 mg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
MBS2581488-02 0.1 mg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details