Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Peptide - middle region

Tsc22d4 Peptide - middle region

Product Specifications

Product Name Alternative

0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2

UniProt

Q99PD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tsc22d4 Rabbit Polyclonal Antibody (orb324688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076399

Preservative

Lyophilized powder

AA Sequence

VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RHEB Protein, N-His
HS914012-01 50 µg

Recombinant Human RHEB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RHEB Protein, N-His
HS914012-02 100 µg

Recombinant Human RHEB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RHEB Protein, N-His
HS914012-03 1 mg

Recombinant Human RHEB Protein, N-His

Sign In for Pricing
View Details
MBOAT2 siRNA (Human)
MBS8233429-01 15 nmol

MBOAT2 siRNA (Human)

Sign In for Pricing
View Details
MBOAT2 siRNA (Human)
MBS8233429-02 30 nmol

MBOAT2 siRNA (Human)

Sign In for Pricing
View Details
MBOAT2 siRNA (Human)
MBS8233429-03 5x 30 nmol

MBOAT2 siRNA (Human)

Sign In for Pricing
View Details