Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Peptide - middle region

Tsc22d4 Peptide - middle region

Product Specifications

Product Name Alternative

0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2

UniProt

Q99PD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tsc22d4 Rabbit Polyclonal Antibody (orb324688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076399

Preservative

Lyophilized powder

AA Sequence

VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tris-HCl Buffer 1M, pH 8.0, Endotoxin Free
40121116-1 100 mL

Tris-HCl Buffer 1M, pH 8.0, Endotoxin Free

Sign In for Pricing
View Details
Usp17lb Mouse shRNA Lentiviral Particle (Locus ID 381944)
TL512709V 500 µL Each

Usp17lb Mouse shRNA Lentiviral Particle (Locus ID 381944)

Sign In for Pricing
View Details
Vmn1r116 CRISPR Activation Plasmid (m2)
sc-437116-ACT-2 20 µg

Vmn1r116 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Anti Cephapirin C antibody
10R-11518 100 ul

Anti Cephapirin C antibody

Sign In for Pricing
View Details
SNAP23 siRNA (Human)
orb1862480-01 15 nmol

SNAP23 siRNA (Human)

Sign In for Pricing
View Details
SNAP23 siRNA (Human)
orb1862480-02 30 nmol

SNAP23 siRNA (Human)

Sign In for Pricing
View Details