Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Peptide - middle region

Tsc22d4 Peptide - middle region

Product Specifications

Product Name Alternative

0610009M14Rik, 1700023B23Rik, AI415410, Thg-1pit, Tilz2

UniProt

Q99PD5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tsc22d4 Rabbit Polyclonal Antibody (orb324688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076399

Preservative

Lyophilized powder

AA Sequence

VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC27A4 Rabbit pAb
E2123165 100 µL

SLC27A4 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Borrelia Recurrentis udk Protein (aa 1-206)
VAng-Lsx2387-500gEcoli 500 µg (E. coli)

Recombinant Borrelia Recurrentis udk Protein (aa 1-206)

Sign In for Pricing
View Details
Rat Tmem165 Pre-designed siRNA Set B
SI214721B 1 Each

Rat Tmem165 Pre-designed siRNA Set B

Sign In for Pricing
View Details
P38 MAPK Polyclonal Antibody, HRP Conjugated
bs-0637R-HRP-01 20 µL

P38 MAPK Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
P38 MAPK Polyclonal Antibody, HRP Conjugated
bs-0637R-HRP-02 100 µL

P38 MAPK Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RGD1565438 3'UTR Luciferase Stable Cell Line
TU219175 1.0 mL

RGD1565438 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details