Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uap1 Peptide - C-terminal region

Uap1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA420407, AA437972, AGX-1, AGX-2, AGX1, AgX, ESTM38, SPAG2

UniProt

Q91YN5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uap1 Rabbit Polyclonal Antibody (orb580674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598567

Preservative

Lyophilized powder

AA Sequence

LKDANDVPIQCEISPLISYAGEGLEGYVADKEFHAPLIIDENGVHELVKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF488A conjugate, 0.1mg/mL
BNC882034-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GOT2 Polyclonal Antibody
E-AB-11280-01 20 µL

GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
GOT2 Polyclonal Antibody
E-AB-11280-02 60 µL

GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
GOT2 Polyclonal Antibody
E-AB-11280-03 120 µL

GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
GOT2 Polyclonal Antibody
E-AB-11280-04 200 µL

GOT2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL-25 protein (His Tag)
PKSH034110-01 20 µg

Recombinant Human IL-25 protein (His Tag)

Sign In for Pricing
View Details