Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCK1 Peptide - N-terminal region

UCK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ12255, URK1, RP11-334J6.5

UniProt

Q9HA47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCK1 Rabbit Polyclonal Antibody (orb585122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113620

Preservative

Lyophilized powder

AA Sequence

QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNM1P24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0619808 1.0 µg DNA

DNM1P24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Goat IL12A (Interleukin 12A) ELISA Kit
MBS8804852-01 48 Well

Goat IL12A (Interleukin 12A) ELISA Kit

Sign In for Pricing
View Details
Goat IL12A (Interleukin 12A) ELISA Kit
MBS8804852-02 96 Well

Goat IL12A (Interleukin 12A) ELISA Kit

Sign In for Pricing
View Details
Goat IL12A (Interleukin 12A) ELISA Kit
MBS8804852-03 5x 96 Well

Goat IL12A (Interleukin 12A) ELISA Kit

Sign In for Pricing
View Details
Goat IL12A (Interleukin 12A) ELISA Kit
MBS8804852-04 10x 96 Well

Goat IL12A (Interleukin 12A) ELISA Kit

Sign In for Pricing
View Details
Cyclic AMP-dependent Transcription Factor ATF-2 (ATF2) Rat ELISA Kit
C6779 96 Tests

Cyclic AMP-dependent Transcription Factor ATF-2 (ATF2) Rat ELISA Kit

Sign In for Pricing
View Details