Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCK1 Peptide - N-terminal region

UCK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ12255, URK1, RP11-334J6.5

UniProt

Q9HA47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCK1 Rabbit Polyclonal Antibody (orb585122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113620

Preservative

Lyophilized powder

AA Sequence

QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL10RA Mouse Monoclonal Antibody [Clone ID: OTI1D10]
M03597-1 100 µL

Anti-IL10RA Mouse Monoclonal Antibody [Clone ID: OTI1D10]

Sign In for Pricing
View Details
Canine Hepatocyte growth factor receptor ELISA kit
GTR10467167 96 Well

Canine Hepatocyte growth factor receptor ELISA kit

Sign In for Pricing
View Details
Ultraviolet wavelength-sensitive opsin Rabbit Polyclonal Antibody (Cy3)
orb974202 100 µL

Ultraviolet wavelength-sensitive opsin Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CBFA2T3 (N) Antibody, Rabbit Polyclonal
orb386813 100 µL

CBFA2T3 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
MPS-Gαi2
HY-P4130 1 Each

MPS-Gαi2

Sign In for Pricing
View Details
Rabbit Anti-LAMA3 antibody
SL1969R-01 50 µL

Rabbit Anti-LAMA3 antibody

Sign In for Pricing
View Details