Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp10 Peptide - C-terminal region

Usp10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC124997

UniProt

Q3KR59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Usp10 Rabbit Polyclonal Antibody (orb584292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029318

Preservative

Lyophilized powder

AA Sequence

RDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r47 Mouse Gene Knockout Kit (CRISPR)
KN519176 1 Kit

Vmn2r47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-01 24 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-02 48 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-H6182-03 96 Tests

Human PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Mouse Alk activation kit by CRISPRa
GA200164 1 Kit

Mouse Alk activation kit by CRISPRa

Sign In for Pricing
View Details
Climatic Chamber BCCL-1412
BCCL-1412 1 Unit

Climatic Chamber BCCL-1412

Sign In for Pricing
View Details