Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP14A Peptide - N-terminal region

UTP14A Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0266, NY-CO-16, SDCCAG16, dJ537K23.3, NYCO16

UniProt

Q9BVJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTP14A Rabbit Polyclonal Antibody (orb581623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006640

Preservative

Lyophilized powder

AA Sequence

KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC14 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV687642 1.0 µg DNA

DNAJC14 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TAF5L (TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 5L, PCAF-associated Factor 65 beta, PAF65-beta, PAF65B)
134189 50 µg

TAF5L (TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 5L, PCAF-associated Factor 65 beta, PAF65-beta, PAF65B)

Sign In for Pricing
View Details
GAP-43
MA1042-M 100μg

GAP-43

Sign In for Pricing
View Details
HSP60 (HSPD1/875), CF740 conjugate, 0.1mg/mL
BNC740875-500 1x 500 µL

HSP60 (HSPD1/875), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIGD1A antibody
70R-17738 50 ul

HIGD1A antibody

Sign In for Pricing
View Details
BCL2L13 Antibody Blocking peptide
orb1445763 500 µg

BCL2L13 Antibody Blocking peptide

Sign In for Pricing
View Details