Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp8 Peptide - middle region

Vamp8 Peptide - middle region

Product Specifications

Product Name Alternative

AU041171, Edb, endobrevin

UniProt

O70404

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp8 Rabbit Polyclonal Antibody (orb584370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058074

Preservative

Lyophilized powder

AA Sequence

NVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOB48R (APOBR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]
TA807169AM 100 µL

APOB48R (APOBR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR560386 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details
LSP1 Recombinant Rabbit Monoclonal Antibody [SN06-25]
ET1611-9 100 µL

LSP1 Recombinant Rabbit Monoclonal Antibody [SN06-25]

Sign In for Pricing
View Details
Human BTNL8 activation kit by CRISPRa
GA112723 1 Kit

Human BTNL8 activation kit by CRISPRa

Sign In for Pricing
View Details
HSD17B1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E5]
TA594454S 30 µL

HSD17B1 Rabbit Monoclonal Antibody [Clone ID: OTIR1E5]

Sign In for Pricing
View Details
NADP/NADPH Microplate Assay Kit
RDSM009 100 Assays

NADP/NADPH Microplate Assay Kit

Sign In for Pricing
View Details