Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp8 Peptide - middle region

Vamp8 Peptide - middle region

Product Specifications

Product Name Alternative

AU041171, Edb, endobrevin

UniProt

O70404

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp8 Rabbit Polyclonal Antibody (orb584370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058074

Preservative

Lyophilized powder

AA Sequence

NVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782S-01 20 Tests

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782S-02 100 Tests

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782S-03 2x 100 Tests

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Ganaxolone
TRC-G235005-2.5G 2.5 g

Ganaxolone

Sign In for Pricing
View Details
CREB (Ab-129) Antibody
8B7052-AAT 50 µg

CREB (Ab-129) Antibody

Sign In for Pricing
View Details
Peracetylated Rhamnose (Mixture of a/b Pyranose and Furanose forms)
TRC-T288230-250MG 250 mg

Peracetylated Rhamnose (Mixture of a/b Pyranose and Furanose forms)

Sign In for Pricing
View Details