Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Peptide - C-terminal region

WWOX Peptide - C-terminal region

Product Specifications

Product Name Alternative

D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1

UniProt

Q9NZC7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWOX Rabbit Polyclonal Antibody (orb585011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570607

Preservative

Lyophilized powder

AA Sequence

DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubiginone B2
MBS6058240-01 1 mg

Rubiginone B2

Sign In for Pricing
View Details
Rubiginone B2
MBS6058240-02 5x 1 mg

Rubiginone B2

Sign In for Pricing
View Details
SALL4 Antibody
KC-2245-01 50 μL

SALL4 Antibody

Sign In for Pricing
View Details
SALL4 Antibody
KC-2245-02 100 µL

SALL4 Antibody

Sign In for Pricing
View Details
SALL4 Antibody
KC-2245-03 1 mL

SALL4 Antibody

Sign In for Pricing
View Details
BACE Antibody (S498)
E45R32498G-4 50 µL

BACE Antibody (S498)

Sign In for Pricing
View Details