Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF2 Peptide - middle region

YIPF2 Peptide - middle region

Product Specifications

Product Name Alternative

FinGER2, MGC3262

UniProt

Q9BWQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YIPF2 Rabbit Polyclonal Antibody (orb325511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076934

Preservative

Lyophilized powder

AA Sequence

LTLVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Transcriptional Enhancer Factor TEF 1 Rabbit Monoclonal Antibody
MA5503-.1 100 µL

Anti-Transcriptional Enhancer Factor TEF 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
H5N1 Hemagglutinin Rabbit Polyclonal Antibody
orb101048-01 50 μL

H5N1 Hemagglutinin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H5N1 Hemagglutinin Rabbit Polyclonal Antibody
orb101048-02 100 µL

H5N1 Hemagglutinin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H5N1 Hemagglutinin Rabbit Polyclonal Antibody
orb101048-03 200 µL

H5N1 Hemagglutinin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SENP7 Antibody
CSB-PA805340LA01HU-01 50 µg

SENP7 Antibody

Sign In for Pricing
View Details
SENP7 Antibody
CSB-PA805340LA01HU-02 100 µg

SENP7 Antibody

Sign In for Pricing
View Details