Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb43 Peptide - C-terminal region

Zbtb43 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700010E06Rik, Zfp297b, mKIAA0414

UniProt

Q9DAI4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zbtb43 Rabbit Polyclonal Antibody (orb324777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082223

Preservative

Lyophilized powder

AA Sequence

HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL
BNC041731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF640R conjugate, 0.1mg/mL
BNC400500-100 1x 100 µL

Progesterone Receptor (PR500), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF640R conjugate, 0.1mg/mL
BNC401147-500 1x 500 µL

CD45RB (PTPRC/1147), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details