Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC3 Peptide - C-terminal region

ZDHHC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp313D2314, FLJ20209, FLJ45940, GODZ, ZNF373, DHHC-3

UniProt

Q9NYG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC3 Rabbit Polyclonal Antibody (orb326299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128651

Preservative

Lyophilized powder

AA Sequence

MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MIP-3 alpha/CCL20 ELISA Kit
EA100313 96 Well

Human MIP-3 alpha/CCL20 ELISA Kit

Sign In for Pricing
View Details
Human TFIIE beta (GTF2E2) activation kit by CRISPRa
GA102006 1 Kit

Human TFIIE beta (GTF2E2) activation kit by CRISPRa

Sign In for Pricing
View Details
L-Glutamine-amide-¹⁵N
TRC-G597002-250MG 250 mg

L-Glutamine-amide-¹⁵N

Sign In for Pricing
View Details
Recombinant Rat Syndecan-1/SDC1 Protein (Fc Tag)
PKSR030216 100 µg

Recombinant Rat Syndecan-1/SDC1 Protein (Fc Tag)

Sign In for Pricing
View Details
RASGEF1C Human qPCR Primer Pair (NM_175062)
HP232193 200 Reactions

RASGEF1C Human qPCR Primer Pair (NM_175062)

Sign In for Pricing
View Details
Human PPM1N activation kit by CRISPRa
GA115623 1 Kit

Human PPM1N activation kit by CRISPRa

Sign In for Pricing
View Details