Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFX Peptide - N-terminal region

ZFX Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF926

UniProt

P17010

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFX Rabbit Polyclonal Antibody (orb576615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003401

Preservative

Lyophilized powder

AA Sequence

MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit
EK12915 48 Tests

Mouse Breast Cancer Susceptibility Protein 2 (BRCA2) ELISA Kit

Sign In for Pricing
View Details
RPL27 Antibody
orb1260621 100 µL

RPL27 Antibody

Sign In for Pricing
View Details
Human C4orf27 (HPF1) (NM_017867) AAV Particle
RC203077A1V 250 µL

Human C4orf27 (HPF1) (NM_017867) AAV Particle

Sign In for Pricing
View Details
CART (55-102) (rat) 1mg
A23122-1 1 mg

CART (55-102) (rat) 1mg

Sign In for Pricing
View Details
Zfp647 (NM_001168276) Mouse Tagged Lenti ORF Clone
MR208576L4 10 µg

Zfp647 (NM_001168276) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CRMP1 (NM_001313) Human Recombinant Protein
TP300483L 1 mg

CRMP1 (NM_001313) Human Recombinant Protein

Sign In for Pricing
View Details