Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFX Peptide - N-terminal region

ZFX Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF926

UniProt

P17010

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFX Rabbit Polyclonal Antibody (orb576615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003401

Preservative

Lyophilized powder

AA Sequence

MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rln1 3'UTR Lenti-reporter-Luc Vector
39628084 1.0 µg

Rln1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GSPT2 Rabbit Polyclonal Antibody (FITC)
orb2105163 100 µL

GSPT2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Immunoglobulin M
AP79982-01 50 µg

Immunoglobulin M

Sign In for Pricing
View Details
Immunoglobulin M
AP79982-02 100 µg

Immunoglobulin M

Sign In for Pricing
View Details
Immunoglobulin M
AP79982-03 1 mg

Immunoglobulin M

Sign In for Pricing
View Details
CDC25A Blocking Peptide
33R-5934 100 ug

CDC25A Blocking Peptide

Sign In for Pricing
View Details