Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan17 Peptide - middle region

Zkscan17 Peptide - middle region

Product Specifications

Product Name Alternative

BC040205, D130067D09, MGC36538, Nizp1, Zfp496, Znf496, RP23-210M6.6

UniProt

Q5SXI5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zkscan17 Rabbit Polyclonal Antibody (orb324715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766529

Preservative

Lyophilized powder

AA Sequence

GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAIP1 Polyclonal Antibody
E-AB-53188-01 20 µL

PAIP1 Polyclonal Antibody

Sign In for Pricing
View Details
PAIP1 Polyclonal Antibody
E-AB-53188-02 60 µL

PAIP1 Polyclonal Antibody

Sign In for Pricing
View Details
PAIP1 Polyclonal Antibody
E-AB-53188-03 120 µL

PAIP1 Polyclonal Antibody

Sign In for Pricing
View Details
PAIP1 Polyclonal Antibody
E-AB-53188-04 200 µL

PAIP1 Polyclonal Antibody

Sign In for Pricing
View Details
L-Cysteic Acid Monohydrate
TRC-C994500-50G 50 g

L-Cysteic Acid Monohydrate

Sign In for Pricing
View Details
EIF2S2 (NM_003908) Human Over-expression Lysate
LY401290 100 µg

EIF2S2 (NM_003908) Human Over-expression Lysate

Sign In for Pricing
View Details