Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan17 Peptide - middle region

Zkscan17 Peptide - middle region

Product Specifications

Product Name Alternative

BC040205, D130067D09, MGC36538, Nizp1, Zfp496, Znf496, RP23-210M6.6

UniProt

Q5SXI5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zkscan17 Rabbit Polyclonal Antibody (orb324715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766529

Preservative

Lyophilized powder

AA Sequence

GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAT1 (SLC7A1) (NM_003045) Human Recombinant Protein
TP309263 20 µg

CAT1 (SLC7A1) (NM_003045) Human Recombinant Protein

Sign In for Pricing
View Details
Orotic Acid Monohydrate
TRC-O691500-25G 25 g

Orotic Acid Monohydrate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800485 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PRKCA Rabbit Monoclonal Antibody [Clone ID: R08-0H5]
TA421641 100 µL

PRKCA Rabbit Monoclonal Antibody [Clone ID: R08-0H5]

Sign In for Pricing
View Details
Blood Bank Refrigerator BBBF-304
BBBF-304 1 Unit

Blood Bank Refrigerator BBBF-304

Sign In for Pricing
View Details
Prp2 Mouse Gene Knockout Kit (CRISPR)
KN513964 1 Kit

Prp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details