Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF189 Peptide - N-terminal region

ZNF189 Peptide - N-terminal region

Product Specifications

UniProt

O75820

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF189 Rabbit Polyclonal Antibody (orb576636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003443

Preservative

Lyophilized powder

AA Sequence

GLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR8H3 qPCR Primer Pair
QH76045S 200 Tests

Human OR8H3 qPCR Primer Pair

Sign In for Pricing
View Details
FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) (MaxLight 405) discontinued
122913-ML405 100 µL

FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Flrt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4748607 1.0 µg DNA

Flrt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Sheep ADAMTS like protein 2 (ADAMTSL2) ELISA kit
GTR10399122 96 Well

Sheep ADAMTS like protein 2 (ADAMTSL2) ELISA kit

Sign In for Pricing
View Details
Ref (Acetyl-Lys7) Polyclonal Antibody
orb311571-01 50 μL

Ref (Acetyl-Lys7) Polyclonal Antibody

Sign In for Pricing
View Details
Ref (Acetyl-Lys7) Polyclonal Antibody
orb311571-02 100 µL

Ref (Acetyl-Lys7) Polyclonal Antibody

Sign In for Pricing
View Details