Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF189 Peptide - N-terminal region

ZNF189 Peptide - N-terminal region

Product Specifications

UniProt

O75820

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF189 Rabbit Polyclonal Antibody (orb576636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003443

Preservative

Lyophilized powder

AA Sequence

GLLTFEDVAVFFTQEEWDYLDPAQRSLYKDVMMENYGNLVSLDVLNRDKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Melanocortin 5 Receptor ELISA Kit
MBS102691-01 48 Well

Camel Melanocortin 5 Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Melanocortin 5 Receptor ELISA Kit
MBS102691-02 96 Well

Camel Melanocortin 5 Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Melanocortin 5 Receptor ELISA Kit
MBS102691-03 5x 96 Well

Camel Melanocortin 5 Receptor ELISA Kit

Sign In for Pricing
View Details
Camel Melanocortin 5 Receptor ELISA Kit
MBS102691-04 10x 96 Well

Camel Melanocortin 5 Receptor ELISA Kit

Sign In for Pricing
View Details
8-Amino-2-naphthol
90027900 25 g

8-Amino-2-naphthol

Sign In for Pricing
View Details
Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1) ELISA Kit
DLR-CXCL1-Mu-01 48 Tests

Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1) ELISA Kit

Sign In for Pricing
View Details