Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF367 Peptide - middle region

ZNF367 Peptide - middle region

Product Specifications

Product Name Alternative

CDC14B, FLJ33970, ZFF29

UniProt

Q7RTV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF367 Rabbit Polyclonal Antibody (orb580202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_710162

Preservative

Lyophilized powder

AA Sequence

DTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcna7 3'UTR GFP Stable Cell Line
TU256541 1.0 mL

Kcna7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-TCP1 eta/CCT7 Antibody Picoband® Fluoro647 Conjugated
A08169-2-Fluoro647 100 µg/Vial

Anti-TCP1 eta/CCT7 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Pseudechis australis Pseudechetoxin
MBS1425552-01 0.02 mg (E-Coli)

Recombinant Pseudechis australis Pseudechetoxin

Sign In for Pricing
View Details
Recombinant Pseudechis australis Pseudechetoxin
MBS1425552-02 0.1 mg (E-Coli)

Recombinant Pseudechis australis Pseudechetoxin

Sign In for Pricing
View Details
Recombinant Pseudechis australis Pseudechetoxin
MBS1425552-03 0.02 mg (Yeast)

Recombinant Pseudechis australis Pseudechetoxin

Sign In for Pricing
View Details
Recombinant Pseudechis australis Pseudechetoxin
MBS1425552-04 0.1 mg (Yeast)

Recombinant Pseudechis australis Pseudechetoxin

Sign In for Pricing
View Details