Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF367 Peptide - middle region

ZNF367 Peptide - middle region

Product Specifications

Product Name Alternative

CDC14B, FLJ33970, ZFF29

UniProt

Q7RTV3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF367 Rabbit Polyclonal Antibody (orb580202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_710162

Preservative

Lyophilized powder

AA Sequence

DTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRP3 Rabbit pAb, PE-Cy5 conjugated
orb2881972 100 µL

RASGRP3 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
MSH3 (NM_002439) Human Over-expression Lysate
LS004437 100 µg

MSH3 (NM_002439) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Hippocampus (Paraffin)
MBS640289-01 5 Slides

Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Hippocampus (Paraffin)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Hippocampus (Paraffin)
MBS640289-02 5x 5 Slides

Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Hippocampus (Paraffin)

Sign In for Pricing
View Details
CD20/MS4A1 Rabbit Monoclonal Antibody
orb2974523-01 50 µg

CD20/MS4A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD20/MS4A1 Rabbit Monoclonal Antibody
orb2974523-02 100 µg

CD20/MS4A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details