Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF790 Peptide - N-terminal region

ZNF790 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20350, MGC62100

UniProt

Q6PG37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF790 Rabbit Polyclonal Antibody (orb581255) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996777

Preservative

Lyophilized powder

AA Sequence

CKNHSLDCLCFRGDWEGNTQFQTLQDNQEECFKQVIRTCEKRPTFNQHTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Skin
CP565438 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
p95 NBS1 (NBN) (C-term) Rabbit Polyclonal Antibody
AP52817PU-N 400 µL

p95 NBS1 (NBN) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHRM2 Human Recombinant Protein, Synthetic Nanodisc
TP721478 10 µg

CHRM2 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
SEC23 (SEC23A) Rabbit Polyclonal Antibody
TA361395 100 µL

SEC23 (SEC23A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MRPL51 activation kit by CRISPRa
GA109683 1 Kit

Human MRPL51 activation kit by CRISPRa

Sign In for Pricing
View Details
MANBAL Human Gene Knockout Kit (CRISPR)
KN400796 1 Kit

MANBAL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details